SCOPe 2.05: Domain d3i5fc_: 3i5f C:

Lineage for d3i5fc_ (3i5f C:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.0: automated matches [191396] (1 protein)
   not a true family

6. Protein automated matches [190513] (27 species)
   not a true protein

7. Species Todarodes pacificus [TaxId:6637] [189005] (2 PDB entries)

8. Domain d3i5fc_: 3i5f C: [246719]
   automated match to d1br1b_
   complexed with adp, mg

Details for d3i5fc_

PDB Entry: 3i5f, 3.1 Å

PDB Description: Crystal structure of squid MG.ADP myosin S1

PDB Compounds: (C:) Myosin catalytic light chain LC-1, mantle muscle

SCOPe Domain Sequences for d3i5fc_:

Sequence; same for both SEQRES and ATOM records:

>d3i5fc_ a.39.1.0 (C:) automated matches {Todarodes pacificus [TaxId: 6637]}
sqltkdeieevrevfdlfdfwdgrdgdvdaakvgdllrclgmnpteaqvhqhggtkkmge
kaykleeilpiyeemsskdtgtaadefmeafktfdregqglissaeirnvlkmlgerite
dqcndiftfcdiredidgnikyedlmkkvmagpfpdksd

Timeline for d3i5fc_:

• d3i5fc_ first appeared in SCOPe 2.04
  
• d3i5fc_ appears in SCOPe 2.06
  
• d3i5fc_ appears in the current release, SCOPe 2.08