| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
| Protein automated matches [190154] (92 species) not a true protein |
| Species Mycobacterium tuberculosis [TaxId:1773] [187939] (6 PDB entries) |
| Domain d3i59a2: 3i59 A:145-223 [246715] Other proteins in same PDB: d3i59a1, d3i59a3, d3i59b1, d3i59b3 automated match to d3i54b2 protein/DNA complex; complexed with cl, n6r, n6s |
PDB Entry: 3i59 (more details), 2.29 Å
SCOPe Domain Sequences for d3i59a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i59a2 a.4.5.0 (A:145-223) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
dvpgrvakqllqlaqrfgtqeggalrvthdltqeeiaqlvgasretvnkaladfahrgwi
rlegksvlisdserlarra
Timeline for d3i59a2: