SCOPe 2.07: Domain d3i59a1: 3i59 A:1-144

Lineage for d3i59a1 (3i59 A:1-144)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.0: automated matches [227198] (1 protein)
   not a true family

6. Protein automated matches [226927] (18 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [231918] (4 PDB entries)

8. Domain d3i59a1: 3i59 A:1-144 [246714]
   Other proteins in same PDB: d3i59a2, d3i59a3, d3i59b2, d3i59b3
   automated match to d3i54b1
   protein/DNA complex; complexed with cl, n6r, n6s

Details for d3i59a1

PDB Entry: 3i59, 2.29 Å

PDB Description: crystal structure of mtbcrp in complex with n6-camp

PDB Compounds: (A:) transcriptional regulator, Crp/Fnr family

SCOPe Domain Sequences for d3i59a1:

Sequence, based on SEQRES records:

>d3i59a1 b.82.3.0 (A:1-144) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mdeilaragifqgvepsaiaaltkqlqpvdfprghtvfaegepgdrlyiiisgkvkigrr
apdgrenlltimgpsdmfgelsifdpgprtssattitevravsmdrdalrswiadrpeis
eqllrvlarrlrrtnnnladlift

Sequence, based on observed residues (ATOM records):

>d3i59a1 b.82.3.0 (A:1-144) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mdeilaragifqgvepsqlqpvdfprghtvfaegepgdrlyiiisgkvkigrrapdenll
timgpsdmfgelsifdpgprtssattitevravsmdrdalrswiadrpeiseqllrvlar
rlrrtnnnladlift

Timeline for d3i59a1:

• d3i59a1 first appeared in SCOPe 2.04
  
• d3i59a1 appears in SCOPe 2.06
  
• d3i59a1 appears in the current release, SCOPe 2.08