SCOPe 2.08: Domain d3i3gb_: 3i3g B:

Lineage for d3i3gb_ (3i3g B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (49 species)
   not a true protein

7. Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [232152] (2 PDB entries)

8. Domain d3i3gb_: 3i3g B: [246710]
   automated match to d3fb3b_

Details for d3i3gb_

PDB Entry: 3i3g, 1.86 Å

PDB Description: crystal structure of trypanosoma brucei n-acetyltransferase (tb11.01.2886) at 1.86a

PDB Compounds: (B:) n-acetyltransferase

SCOPe Domain Sequences for d3i3gb_:

Sequence; same for both SEQRES and ATOM records:

>d3i3gb_ d.108.1.0 (B:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
vdlelrvleesdlsshlellghlteapplsgvelaniadmrrragivtkvfchqptgriv
gsaslmiqpkftrggravghiedvvvdpsyrgaglgkalimdlceisrskgcykvildss
ekslpfyeklgfraherqmrldl

Timeline for d3i3gb_:

• d3i3gb_ first appeared in SCOPe 2.04
  
• d3i3gb_ appears in SCOPe 2.07