SCOP 1.73: Domain d2oxia1: 2oxi A:1-163,A:340-374

Lineage for d2oxia1 (2oxi A:1-163,A:340-374)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)
   contains barrel, partly opened; n*=4, S*=8; meander

4. Superfamily b.35.1: GroES-like [50129] (2 families)

5. Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
   C-terminal domain is alpha/beta (classical Rossmann-fold)

6. Protein Alcohol dehydrogenase [50137] (9 species)
   contains a Zn-finger subdomain, residues 94-117

7. Species Horse (Equus caballus) [TaxId:9796] [50138] (36 PDB entries)

8. Domain d2oxia1: 2oxi A:1-163,A:340-374 [24671]
   Other proteins in same PDB: d2oxia2, d2oxib2

Details for d2oxia1

PDB Entry: 2oxi, 2.1 Å

PDB Description: refined crystal structure of cu-substituted alcohol dehydrogenase at 2.1 angstroms resolution

PDB Compounds: (A:) alcohol dehydrogenase

SCOP Domain Sequences for d2oxia1:

Sequence; same for both SEQRES and ATOM records:

>d2oxia1 b.35.1.2 (A:1-163,A:340-374) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]}
stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaaXfaldplithvlpfeki
negfdllrsgesirtiltf

Timeline for d2oxia1:

• d2oxia1 first appeared (with stable ids) in SCOP 1.55
  
• d2oxia1 appears in SCOP 1.71
  
• d2oxia1 appears in SCOP 1.75
  
• d2oxia1 appears in the current release, SCOPe 2.08