Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
Protein beta-Galactosidase, domain 3 [51510] (3 species) |
Species Escherichia coli [TaxId:562] [51511] (45 PDB entries) Uniprot P00722 |
Domain d3i3ed3: 3i3e D:334-625 [246706] Other proteins in same PDB: d3i3ea1, d3i3ea2, d3i3ea4, d3i3ea5, d3i3eb1, d3i3eb2, d3i3eb4, d3i3eb5, d3i3ec1, d3i3ec2, d3i3ec4, d3i3ec5, d3i3ed1, d3i3ed2, d3i3ed4, d3i3ed5 automated match to d1jz7a5 complexed with dms, mg, na |
PDB Entry: 3i3e (more details), 2.1 Å
SCOPe Domain Sequences for d3i3ed3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i3ed3 c.1.8.3 (D:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]} evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp avpkwsikkwlslpgetrplilceyahaagnslggfakywqafrqyprlqggfvwdwvdq slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq
Timeline for d3i3ed3:
View in 3D Domains from same chain: (mouse over for more information) d3i3ed1, d3i3ed2, d3i3ed4, d3i3ed5 |