![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
![]() | Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) ![]() probable carbohydrate-binding domain in enzymes acting on sugars |
![]() | Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein) automatically mapped to Pfam PF02929 |
![]() | Protein beta-Galactosidase, domain 5 [49996] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [49997] (46 PDB entries) Uniprot P00722 |
![]() | Domain d3i3ec5: 3i3e C:731-1023 [246703] Other proteins in same PDB: d3i3ea1, d3i3ea2, d3i3ea3, d3i3ea4, d3i3eb1, d3i3eb2, d3i3eb3, d3i3eb4, d3i3ec1, d3i3ec2, d3i3ec3, d3i3ec4, d3i3ed1, d3i3ed2, d3i3ed3, d3i3ed4 automated match to d1jz8a4 complexed with dms, mg, na |
PDB Entry: 3i3e (more details), 2.1 Å
SCOPe Domain Sequences for d3i3ec5:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i3ec5 b.30.5.1 (C:731-1023) beta-Galactosidase, domain 5 {Escherichia coli [TaxId: 562]} paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
Timeline for d3i3ec5:
![]() Domains from same chain: (mouse over for more information) d3i3ec1, d3i3ec2, d3i3ec3, d3i3ec4 |