SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3i3ec4 (3i3e C:626-730)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2030012Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2030013Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 protein domains)
  6. 2030014Protein beta-Galactosidase, domains 2 and 4 [49305] (2 species)
  7. 2030028Species Escherichia coli [TaxId:562] [49306] (42 PDB entries)
    Uniprot P00722
  8. 2030162Domain d3i3ec4: 3i3e C:626-730 [246702]
    Other proteins in same PDB: d3i3ea1, d3i3ea3, d3i3ea5, d3i3eb1, d3i3eb3, d3i3eb5, d3i3ec1, d3i3ec3, d3i3ec5, d3i3ed1, d3i3ed3, d3i3ed5
    automated match to d1jz8a2
    complexed with dms, mg, na

Details for d3i3ec4

PDB Entry: 3i3e (more details), 2.1 Å

PDB Description: e. coli (lacz) beta-galactosidase (m542a)
PDB Compounds: (C:) beta-galactosidase

SCOPe Domain Sequences for d3i3ec4:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i3ec4 b.1.4.1 (C:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl

SCOPe Domain Coordinates for d3i3ec4:

Click to download the PDB-style file with coordinates for d3i3ec4.
(The format of our PDB-style files is described here.)

Timeline for d3i3ec4: