Class b: All beta proteins [48724] (176 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins) |
Protein beta-Galactosidase [49804] (2 species) |
Species Escherichia coli [TaxId:562] [49805] (42 PDB entries) Uniprot P00722 |
Domain d3i3ec1: 3i3e C:13-219 [246699] Other proteins in same PDB: d3i3ea2, d3i3ea3, d3i3ea4, d3i3ea5, d3i3eb2, d3i3eb3, d3i3eb4, d3i3eb5, d3i3ec2, d3i3ec3, d3i3ec4, d3i3ec5, d3i3ed2, d3i3ed3, d3i3ed4, d3i3ed5 automated match to d1f49a3 complexed with dms, mg, na |
PDB Entry: 3i3e (more details), 2.1 Å
SCOPe Domain Sequences for d3i3ec1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i3ec1 b.18.1.5 (C:13-219) beta-Galactosidase {Escherichia coli [TaxId: 562]} rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws dgsyledqdmwrmsgifrdvsllhkpt
Timeline for d3i3ec1:
View in 3D Domains from same chain: (mouse over for more information) d3i3ec2, d3i3ec3, d3i3ec4, d3i3ec5 |