Lineage for d3i3eb3 (3i3e B:334-625)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2830557Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2830645Protein beta-Galactosidase, domain 3 [51510] (3 species)
  7. 2830653Species Escherichia coli [TaxId:562] [51511] (46 PDB entries)
    Uniprot P00722
  8. 2830687Domain d3i3eb3: 3i3e B:334-625 [246696]
    Other proteins in same PDB: d3i3ea1, d3i3ea2, d3i3ea4, d3i3ea5, d3i3eb1, d3i3eb2, d3i3eb4, d3i3eb5, d3i3ec1, d3i3ec2, d3i3ec4, d3i3ec5, d3i3ed1, d3i3ed2, d3i3ed4, d3i3ed5
    automated match to d1jz7a5
    complexed with dms, mg, na

Details for d3i3eb3

PDB Entry: 3i3e (more details), 2.1 Å

PDB Description: e. coli (lacz) beta-galactosidase (m542a)
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d3i3eb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i3eb3 c.1.8.3 (B:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahaagnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOPe Domain Coordinates for d3i3eb3:

Click to download the PDB-style file with coordinates for d3i3eb3.
(The format of our PDB-style files is described here.)

Timeline for d3i3eb3: