Lineage for d3i3eb1 (3i3e B:13-219)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383785Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2383786Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2383918Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins)
  6. 2383919Protein beta-Galactosidase [49804] (3 species)
  7. 2383927Species Escherichia coli [TaxId:562] [49805] (45 PDB entries)
    Uniprot P00722
  8. 2383985Domain d3i3eb1: 3i3e B:13-219 [246694]
    Other proteins in same PDB: d3i3ea2, d3i3ea3, d3i3ea4, d3i3ea5, d3i3eb2, d3i3eb3, d3i3eb4, d3i3eb5, d3i3ec2, d3i3ec3, d3i3ec4, d3i3ec5, d3i3ed2, d3i3ed3, d3i3ed4, d3i3ed5
    automated match to d1f49a3
    complexed with dms, mg, na

Details for d3i3eb1

PDB Entry: 3i3e (more details), 2.1 Å

PDB Description: e. coli (lacz) beta-galactosidase (m542a)
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d3i3eb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i3eb1 b.18.1.5 (B:13-219) beta-Galactosidase {Escherichia coli [TaxId: 562]}
rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
dgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d3i3eb1:

Click to download the PDB-style file with coordinates for d3i3eb1.
(The format of our PDB-style files is described here.)

Timeline for d3i3eb1: