Lineage for d3i3ea4 (3i3e A:626-730)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2762430Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2762431Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)
  6. 2762432Protein beta-Galactosidase, domains 2 and 4 [49305] (3 species)
  7. 2762446Species Escherichia coli [TaxId:562] [49306] (46 PDB entries)
    Uniprot P00722
  8. 2762512Domain d3i3ea4: 3i3e A:626-730 [246692]
    Other proteins in same PDB: d3i3ea1, d3i3ea3, d3i3ea5, d3i3eb1, d3i3eb3, d3i3eb5, d3i3ec1, d3i3ec3, d3i3ec5, d3i3ed1, d3i3ed3, d3i3ed5
    automated match to d1jz8a2
    complexed with dms, mg, na

Details for d3i3ea4

PDB Entry: 3i3e (more details), 2.1 Å

PDB Description: e. coli (lacz) beta-galactosidase (m542a)
PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d3i3ea4:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i3ea4 b.1.4.1 (A:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl

SCOPe Domain Coordinates for d3i3ea4:

Click to download the PDB-style file with coordinates for d3i3ea4.
(The format of our PDB-style files is described here.)

Timeline for d3i3ea4: