Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) |
Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins) |
Protein beta-Galactosidase, domains 2 and 4 [49305] (2 species) |
Species Escherichia coli [TaxId:562] [49306] (42 PDB entries) Uniprot P00722 |
Domain d3i3ea2: 3i3e A:220-333 [246690] Other proteins in same PDB: d3i3ea1, d3i3ea3, d3i3ea5, d3i3eb1, d3i3eb3, d3i3eb5, d3i3ec1, d3i3ec3, d3i3ec5, d3i3ed1, d3i3ed3, d3i3ed5 automated match to d1jz8a1 complexed with dms, mg, na |
PDB Entry: 3i3e (more details), 2.1 Å
SCOPe Domain Sequences for d3i3ea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i3ea2 b.1.4.1 (A:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]} tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr
Timeline for d3i3ea2:
View in 3D Domains from same chain: (mouse over for more information) d3i3ea1, d3i3ea3, d3i3ea4, d3i3ea5 |