Lineage for d2ohxa1 (2ohx A:1-163,A:340-374)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 461906Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 461907Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 461986Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (13 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 462004Protein Alcohol dehydrogenase [50137] (9 species)
    contains a Zn-finger subdomain, residues 94-117
  7. 462032Species Horse (Equus caballus) [TaxId:9796] [50138] (33 PDB entries)
  8. 462063Domain d2ohxa1: 2ohx A:1-163,A:340-374 [24669]
    Other proteins in same PDB: d2ohxa2, d2ohxb2

Details for d2ohxa1

PDB Entry: 2ohx (more details), 1.8 Å

PDB Description: refined crystal structure of liver alcohol dehydrogenase-nadh complex at 1.8 angstroms resolution

SCOP Domain Sequences for d2ohxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ohxa1 b.35.1.2 (A:1-163,A:340-374) Alcohol dehydrogenase {Horse (Equus caballus)}
stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaaXfaldplithvlpfeki
negfdllrsgesirtiltf

SCOP Domain Coordinates for d2ohxa1:

Click to download the PDB-style file with coordinates for d2ohxa1.
(The format of our PDB-style files is described here.)

Timeline for d2ohxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ohxa2