Lineage for d3i3dd3 (3i3d D:334-625)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1568602Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1569213Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 1569297Protein beta-Galactosidase, domain 3 [51510] (2 species)
  7. 1569305Species Escherichia coli [TaxId:562] [51511] (41 PDB entries)
    Uniprot P00722
  8. 1569377Domain d3i3dd3: 3i3d D:334-625 [246686]
    Other proteins in same PDB: d3i3da1, d3i3da2, d3i3da4, d3i3da5, d3i3db1, d3i3db2, d3i3db4, d3i3db5, d3i3dc1, d3i3dc2, d3i3dc4, d3i3dc5, d3i3dd1, d3i3dd2, d3i3dd4, d3i3dd5
    automated match to d1jz7a5
    complexed with dms, ipt, mg, na

Details for d3i3dd3

PDB Entry: 3i3d (more details), 2.2 Å

PDB Description: e. coli (lacz) beta-galactosidase (m542a) in complex with iptg
PDB Compounds: (D:) beta-galactosidase

SCOPe Domain Sequences for d3i3dd3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i3dd3 c.1.8.3 (D:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahaagnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOPe Domain Coordinates for d3i3dd3:

Click to download the PDB-style file with coordinates for d3i3dd3.
(The format of our PDB-style files is described here.)

Timeline for d3i3dd3: