Lineage for d3i3dc5 (3i3d C:731-1023)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2781474Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2781620Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2781621Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein)
    automatically mapped to Pfam PF02929
  6. 2781622Protein beta-Galactosidase, domain 5 [49996] (2 species)
  7. 2781630Species Escherichia coli [TaxId:562] [49997] (46 PDB entries)
    Uniprot P00722
  8. 2781705Domain d3i3dc5: 3i3d C:731-1023 [246683]
    Other proteins in same PDB: d3i3da1, d3i3da2, d3i3da3, d3i3da4, d3i3db1, d3i3db2, d3i3db3, d3i3db4, d3i3dc1, d3i3dc2, d3i3dc3, d3i3dc4, d3i3dd1, d3i3dd2, d3i3dd3, d3i3dd4
    automated match to d1jz8a4
    complexed with dms, ipt, mg, na

Details for d3i3dc5

PDB Entry: 3i3d (more details), 2.2 Å

PDB Description: e. coli (lacz) beta-galactosidase (m542a) in complex with iptg
PDB Compounds: (C:) beta-galactosidase

SCOPe Domain Sequences for d3i3dc5:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i3dc5 b.30.5.1 (C:731-1023) beta-Galactosidase, domain 5 {Escherichia coli [TaxId: 562]}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOPe Domain Coordinates for d3i3dc5:

Click to download the PDB-style file with coordinates for d3i3dc5.
(The format of our PDB-style files is described here.)

Timeline for d3i3dc5: