Lineage for d3btod1 (3bto D:1-163,D:340-374)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 797352Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 797353Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 797474Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 797492Protein Alcohol dehydrogenase [50137] (9 species)
    contains a Zn-finger subdomain, residues 94-117
  7. 797520Species Horse (Equus caballus) [TaxId:9796] [50138] (36 PDB entries)
    Uniprot P00327
  8. 797547Domain d3btod1: 3bto D:1-163,D:340-374 [24668]
    Other proteins in same PDB: d3btoa2, d3btob2, d3btoc2, d3btod2
    complexed with nad, ssb, zn

Details for d3btod1

PDB Entry: 3bto (more details), 1.66 Å

PDB Description: horse liver alcohol dehydrogenase complexed to nadh and (1s,3s)3-butylthiolane 1-oxide
PDB Compounds: (D:) liver alcohol dehydrogenase

SCOP Domain Sequences for d3btod1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3btod1 b.35.1.2 (D:1-163,D:340-374) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]}
stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaaXfaldplithvlpfeki
negfdllrsgesirtiltf

SCOP Domain Coordinates for d3btod1:

Click to download the PDB-style file with coordinates for d3btod1.
(The format of our PDB-style files is described here.)

Timeline for d3btod1: