SCOP 1.61: Domain d3btod1: 3bto D:1-174,D:325-374

Lineage for d3btod1 (3bto D:1-174,D:325-374)

Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds)
Fold b.35: GroES-like [50128] (2 superfamilies)
Superfamily b.35.1: GroES-like [50129] (2 families)
Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (5 proteins)
Protein Alcohol dehydrogenase [50137] (4 species)
Species Horse (Equus caballus) [TaxId:9796] [50138] (26 PDB entries)
Domain d3btod1: 3bto D:1-174,D:325-374 [24668]
Other proteins in same PDB: d3btoa2, d3btob2, d3btoc2, d3btod2

Details for d3btod1

PDB Entry: 3bto (more details), 1.66 Å

PDB Description: horse liver alcohol dehydrogenase complexed to nadh and (1s,3s)3-butylthiolane 1-oxide

SCOP Domain Sequences for d3btod1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3btod1 b.35.1.2 (D:1-174,D:325-374) Alcohol dehydrogenase {Horse (Equus caballus)}
stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaasplekvcligcXkdsvp
klvadfmakkfaldplithvlpfekinegfdllrsgesirtiltf

SCOP Domain Coordinates for d3btod1:

Click to download the PDB-style file with coordinates for d3btod1.
(The format of our PDB-style files is described here.)

Timeline for d3btod1: