![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
![]() | Protein beta-Galactosidase, domain 3 [51510] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [51511] (42 PDB entries) Uniprot P00722 |
![]() | Domain d3i3da3: 3i3d A:334-625 [246671] Other proteins in same PDB: d3i3da1, d3i3da2, d3i3da4, d3i3da5, d3i3db1, d3i3db2, d3i3db4, d3i3db5, d3i3dc1, d3i3dc2, d3i3dc4, d3i3dc5, d3i3dd1, d3i3dd2, d3i3dd4, d3i3dd5 automated match to d1jz7a5 complexed with dms, ipt, mg, na |
PDB Entry: 3i3d (more details), 2.2 Å
SCOPe Domain Sequences for d3i3da3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i3da3 c.1.8.3 (A:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]} evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp avpkwsikkwlslpgetrplilceyahaagnslggfakywqafrqyprlqggfvwdwvdq slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq
Timeline for d3i3da3:
![]() Domains from same chain: (mouse over for more information) d3i3da1, d3i3da2, d3i3da4, d3i3da5 |