![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins) |
![]() | Protein beta-Galactosidase [49804] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [49805] (46 PDB entries) Uniprot P00722 |
![]() | Domain d3i3da1: 3i3d A:13-219 [246669] Other proteins in same PDB: d3i3da2, d3i3da3, d3i3da4, d3i3da5, d3i3db2, d3i3db3, d3i3db4, d3i3db5, d3i3dc2, d3i3dc3, d3i3dc4, d3i3dc5, d3i3dd2, d3i3dd3, d3i3dd4, d3i3dd5 automated match to d1f49a3 complexed with dms, ipt, mg, na |
PDB Entry: 3i3d (more details), 2.2 Å
SCOPe Domain Sequences for d3i3da1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i3da1 b.18.1.5 (A:13-219) beta-Galactosidase {Escherichia coli [TaxId: 562]} rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws dgsyledqdmwrmsgifrdvsllhkpt
Timeline for d3i3da1:
![]() Domains from same chain: (mouse over for more information) d3i3da2, d3i3da3, d3i3da4, d3i3da5 |