![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
![]() | Protein beta-Galactosidase, domain 3 [51510] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [51511] (41 PDB entries) Uniprot P00722 |
![]() | Domain d3i3bc3: 3i3b C:334-625 [246661] Other proteins in same PDB: d3i3ba1, d3i3ba2, d3i3ba4, d3i3ba5, d3i3bb1, d3i3bb2, d3i3bb4, d3i3bb5, d3i3bc1, d3i3bc2, d3i3bc4, d3i3bc5, d3i3bd1, d3i3bd2, d3i3bd4, d3i3bd5 automated match to d1jz7a5 complexed with 149, dms, mg, na |
PDB Entry: 3i3b (more details), 2.2 Å
SCOPe Domain Sequences for d3i3bc3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i3bc3 c.1.8.3 (C:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]} evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp avpkwsikkwlslpgetrplilceyahaagnslggfakywqafrqyprlqggfvwdwvdq slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq
Timeline for d3i3bc3:
![]() Domains from same chain: (mouse over for more information) d3i3bc1, d3i3bc2, d3i3bc4, d3i3bc5 |