Lineage for d3i3bb5 (3i3b B:731-1023)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1534928Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 1535067Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 1535068Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein)
    automatically mapped to Pfam PF02929
  6. 1535069Protein beta-Galactosidase, domain 5 [49996] (2 species)
  7. 1535077Species Escherichia coli [TaxId:562] [49997] (41 PDB entries)
    Uniprot P00722
  8. 1535163Domain d3i3bb5: 3i3b B:731-1023 [246658]
    Other proteins in same PDB: d3i3ba1, d3i3ba2, d3i3ba3, d3i3ba4, d3i3bb1, d3i3bb2, d3i3bb3, d3i3bb4, d3i3bc1, d3i3bc2, d3i3bc3, d3i3bc4, d3i3bd1, d3i3bd2, d3i3bd3, d3i3bd4
    automated match to d1jz8a4
    complexed with 149, dms, mg, na

Details for d3i3bb5

PDB Entry: 3i3b (more details), 2.2 Å

PDB Description: e.coli (lacz) beta-galactosidase (m542a) in complex with d- galactopyranosyl-1-on
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d3i3bb5:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i3bb5 b.30.5.1 (B:731-1023) beta-Galactosidase, domain 5 {Escherichia coli [TaxId: 562]}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOPe Domain Coordinates for d3i3bb5:

Click to download the PDB-style file with coordinates for d3i3bb5.
(The format of our PDB-style files is described here.)

Timeline for d3i3bb5: