Lineage for d3i3bb2 (3i3b B:220-333)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2036362Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2036363Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)
  6. 2036364Protein beta-Galactosidase, domains 2 and 4 [49305] (2 species)
  7. 2036378Species Escherichia coli [TaxId:562] [49306] (42 PDB entries)
    Uniprot P00722
  8. 2036557Domain d3i3bb2: 3i3b B:220-333 [246655]
    Other proteins in same PDB: d3i3ba1, d3i3ba3, d3i3ba5, d3i3bb1, d3i3bb3, d3i3bb5, d3i3bc1, d3i3bc3, d3i3bc5, d3i3bd1, d3i3bd3, d3i3bd5
    automated match to d1jz8a1
    complexed with 149, dms, mg, na

Details for d3i3bb2

PDB Entry: 3i3b (more details), 2.2 Å

PDB Description: e.coli (lacz) beta-galactosidase (m542a) in complex with d- galactopyranosyl-1-on
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d3i3bb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i3bb2 b.1.4.1 (B:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr

SCOPe Domain Coordinates for d3i3bb2:

Click to download the PDB-style file with coordinates for d3i3bb2.
(The format of our PDB-style files is described here.)

Timeline for d3i3bb2: