![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) ![]() |
![]() | Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins) |
![]() | Protein beta-Galactosidase, domains 2 and 4 [49305] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [49306] (41 PDB entries) Uniprot P00722 |
![]() | Domain d3i3bb2: 3i3b B:220-333 [246655] Other proteins in same PDB: d3i3ba1, d3i3ba3, d3i3ba5, d3i3bb1, d3i3bb3, d3i3bb5, d3i3bc1, d3i3bc3, d3i3bc5, d3i3bd1, d3i3bd3, d3i3bd5 automated match to d1jz8a1 complexed with 149, dms, mg, na |
PDB Entry: 3i3b (more details), 2.2 Å
SCOPe Domain Sequences for d3i3bb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i3bb2 b.1.4.1 (B:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]} tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr
Timeline for d3i3bb2:
![]() Domains from same chain: (mouse over for more information) d3i3bb1, d3i3bb3, d3i3bb4, d3i3bb5 |