![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.43.3: Translation proteins [50447] (7 families) ![]() |
![]() | Family b.43.3.1: Elongation factors [50448] (10 proteins) |
![]() | Protein Initiation factor eIF2 gamma subunit, domain II [74962] (3 species) |
![]() | Species Sulfolobus solfataricus [TaxId:2287] [141335] (10 PDB entries) Uniprot Q980A5 207-320 |
![]() | Domain d3i1fb2: 3i1f B:207-320 [246644] Other proteins in same PDB: d3i1fa1, d3i1fa3, d3i1fb1, d3i1fb3 automated match to d2qn6a1 protein/RNA complex; complexed with gcp, po4 |
PDB Entry: 3i1f (more details), 2.5 Å
SCOPe Domain Sequences for d3i1fb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i1fb2 b.43.3.1 (B:207-320) Initiation factor eIF2 gamma subunit, domain II {Sulfolobus solfataricus [TaxId: 2287]} rdlsqkpvmlvirsfdvnkpgtqfnelkggviggsiiqglfkvdqeikvlpglrvekqgk vsyepiftkissirfgdeefkeakpgglvaigtyldpsltkadnllgsiitlad
Timeline for d3i1fb2: