SCOPe 2.07: Domain d3i1fa2: 3i1f A:207-320

Lineage for d3i1fa2 (3i1f A:207-320)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.3: Translation proteins [50447] (7 families)

5. Family b.43.3.1: Elongation factors [50448] (11 proteins)

6. Protein Initiation factor eIF2 gamma subunit, domain II [74962] (3 species)

7. Species Sulfolobus solfataricus [TaxId:2287] [141335] (10 PDB entries)
   Uniprot Q980A5 207-320

8. Domain d3i1fa2: 3i1f A:207-320 [246641]
   Other proteins in same PDB: d3i1fa1, d3i1fa3, d3i1fb1, d3i1fb3
   automated match to d2qn6a1
   protein/RNA complex; complexed with gcp, po4

Details for d3i1fa2

PDB Entry: 3i1f, 2.5 Å

PDB Description: Gamma-subunit of the translation initiation factor 2 from S. solfataricus in complex with Gpp(CH2)p

PDB Compounds: (A:) Translation initiation factor 2 subunit gamma

SCOPe Domain Sequences for d3i1fa2:

Sequence; same for both SEQRES and ATOM records:

>d3i1fa2 b.43.3.1 (A:207-320) Initiation factor eIF2 gamma subunit, domain II {Sulfolobus solfataricus [TaxId: 2287]}
rdlsqkpvmlvirsfdvnkpgtqfnelkggviggsiiqglfkvdqeikvlpglrvekqgk
vsyepiftkissirfgdeefkeakpgglvaigtyldpsltkadnllgsiitlad

Timeline for d3i1fa2:

• d3i1fa2 first appeared in SCOPe 2.04
  
• d3i1fa2 appears in SCOPe 2.06
  
• d3i1fa2 appears in the current release, SCOPe 2.08