Lineage for d3i1fa2 (3i1f A:207-320)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2062589Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2062651Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2062652Family b.43.3.1: Elongation factors [50448] (10 proteins)
  6. 2062785Protein Initiation factor eIF2 gamma subunit, domain II [74962] (3 species)
  7. 2062794Species Sulfolobus solfataricus [TaxId:2287] [141335] (10 PDB entries)
    Uniprot Q980A5 207-320
  8. 2062801Domain d3i1fa2: 3i1f A:207-320 [246641]
    Other proteins in same PDB: d3i1fa1, d3i1fa3, d3i1fb1, d3i1fb3
    automated match to d2qn6a1
    protein/RNA complex; complexed with gcp, po4

Details for d3i1fa2

PDB Entry: 3i1f (more details), 2.5 Å

PDB Description: Gamma-subunit of the translation initiation factor 2 from S. solfataricus in complex with Gpp(CH2)p
PDB Compounds: (A:) Translation initiation factor 2 subunit gamma

SCOPe Domain Sequences for d3i1fa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i1fa2 b.43.3.1 (A:207-320) Initiation factor eIF2 gamma subunit, domain II {Sulfolobus solfataricus [TaxId: 2287]}
rdlsqkpvmlvirsfdvnkpgtqfnelkggviggsiiqglfkvdqeikvlpglrvekqgk
vsyepiftkissirfgdeefkeakpgglvaigtyldpsltkadnllgsiitlad

SCOPe Domain Coordinates for d3i1fa2:

Click to download the PDB-style file with coordinates for d3i1fa2.
(The format of our PDB-style files is described here.)

Timeline for d3i1fa2: