SCOPe 2.04: Domain d3i1fa1: 3i1f A:2-206

Lineage for d3i1fa1 (3i1f A:2-206)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Initiation factor eIF2 gamma subunit, N-terminal (G) domain [75204] (3 species)
   includes rubredoxin-like zinc finger insert domain, res. 56-83, similar that of the Nop10-like family (144211)

7. Species Sulfolobus solfataricus [TaxId:2287] [142227] (10 PDB entries)
   Uniprot Q980A5 2-206

8. Domain d3i1fa1: 3i1f A:2-206 [246640]
   Other proteins in same PDB: d3i1fa2, d3i1fa3, d3i1fb2, d3i1fb3
   automated match to d2qn6a3
   protein/RNA complex; complexed with gcp, po4

Details for d3i1fa1

PDB Entry: 3i1f, 2.5 Å

PDB Description: Gamma-subunit of the translation initiation factor 2 from S. solfataricus in complex with Gpp(CH2)p

PDB Compounds: (A:) Translation initiation factor 2 subunit gamma

SCOPe Domain Sequences for d3i1fa1:

Sequence; same for both SEQRES and ATOM records:

>d3i1fa1 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]}
awpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvces
ckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaan
epfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpii
pvsalhkinidsliegieeyiktpy

Timeline for d3i1fa1:

• d3i1fa1 is new in SCOPe 2.04-stable
  
• d3i1fa1 appears in SCOPe 2.05
  
• d3i1fa1 appears in the current release, SCOPe 2.08