Lineage for d1ee2b1 (1ee2 B:1-162,B:339-373)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 558060Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 558061Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 558147Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 558165Protein Alcohol dehydrogenase [50137] (9 species)
    contains a Zn-finger subdomain, residues 94-117
  7. 558193Species Horse (Equus caballus) [TaxId:9796] [50138] (34 PDB entries)
  8. 558206Domain d1ee2b1: 1ee2 B:1-162,B:339-373 [24664]
    Other proteins in same PDB: d1ee2a2, d1ee2b2
    steroid-active isozyme
    complexed with chd, nad, zn

Details for d1ee2b1

PDB Entry: 1ee2 (more details), 1.54 Å

PDB Description: the structure of steroid-active alcohol dehydrogenase at 1.54 a resolution

SCOP Domain Sequences for d1ee2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ee2b1 b.35.1.2 (B:1-162,B:339-373) Alcohol dehydrogenase {Horse (Equus caballus)}
stagkvikckaavlweqkkpfsieevevappkahevrikmvaagicrsddhvvsgtlvap
lpviagheaagivesigegvttvrpgdkviplfipqcgkcsvckhpegnlclknlsmprg
tmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaaXfaldplithvlpfekin
egfdllrsgksirtiltf

SCOP Domain Coordinates for d1ee2b1:

Click to download the PDB-style file with coordinates for d1ee2b1.
(The format of our PDB-style files is described here.)

Timeline for d1ee2b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ee2b2