Lineage for d3hzre_ (3hzr E:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1841351Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1841352Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 1841999Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 1842000Protein automated matches [190459] (41 species)
    not a true protein
  7. 1842063Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [255876] (1 PDB entry)
  8. 1842068Domain d3hzre_: 3hzr E: [246638]
    automated match to d1ulhb_

Details for d3hzre_

PDB Entry: 3hzr (more details), 3 Å

PDB Description: Tryptophanyl-tRNA synthetase homolog from Entamoeba histolytica
PDB Compounds: (E:) Tryptophanyl-tRNA synthetase

SCOPe Domain Sequences for d3hzre_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hzre_ c.26.1.0 (E:) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}
psqllqsfttrttdynqlinsvginaitpqqiqrieklsgkaphhylsrgvflaeksldk
flddveakkptfifiqkypqkevaleeyitlefarylqdafniqviiqilddikvlnrea
tineaskmsndlmkyilafgfnedktfiytdyqyfgkmyrtislvekataynvvqpffnf
eysdnigklaspsimtasmfsqsyshffssparclvldsiknvqfhsiidqiattlnfiq
ptvlfhkmvpllsgvtkfdipsdhnsillsdnakqverkinklafsggrntteehkklgg
qcdidvsfqllnifssdnaqvkdveekyskgellsgelkkivsasmkdfivaydakkkpi
ttaylkayisktkf

SCOPe Domain Coordinates for d3hzre_:

Click to download the PDB-style file with coordinates for d3hzre_.
(The format of our PDB-style files is described here.)

Timeline for d3hzre_: