Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.0: automated matches [191377] (1 protein) not a true family |
Protein automated matches [190459] (61 species) not a true protein |
Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [255876] (1 PDB entry) |
Domain d3hzrc_: 3hzr C: [246636] automated match to d1ulhb_ |
PDB Entry: 3hzr (more details), 3 Å
SCOPe Domain Sequences for d3hzrc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hzrc_ c.26.1.0 (C:) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} psqllqsfttrttdynqlinsvginaitpqqiqrieklsgkaphhylsrgvflaeksldk flddveakkptfifiqkypqkevaleeyitlefarylqdafniqviiqilddikvlnrea tineaskmsndlmkyilafgfnedktfiytdyqyfgkmyrtislvekataynvvqpffnf eysdnigklaspsimtasmfsqsyshffssparclvldsiknvqfhsiidqiattlnfiq ptvlfhkmvpllsgvtkfdipsdhnsillsdnakqverkinklafsggrntteehkklgg qcdidvsfqllnifssdnaqvkdveekyskgellsgelkkivsasmkdfivaydakkkpi ttaylkayisktkf
Timeline for d3hzrc_: