| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
| Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
| Protein automated matches [190543] (131 species) not a true protein |
| Species Mycobacterium tuberculosis [TaxId:1773] [232505] (4 PDB entries) |
| Domain d3hzob_: 3hzo B: [246633] Other proteins in same PDB: d3hzoa2 automated match to d3hssb_ complexed with edo, mla, na |
PDB Entry: 3hzo (more details), 2.6 Å
SCOPe Domain Sequences for d3hzob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hzob_ c.69.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
inlayddngtgdpvvfiagrggagrtwhphqvpaflaagyrcitfdnrgigatenaegft
tqtmvadtaalietldiaparvvgvsmgafiaqelmvvapelvssavlmatrgrldrarq
ffnkaeaelydsgvqlpptydararllenfsrktlnddvavgdwiamfsmwpikstpglr
cqldcapqtnrlpayrniaapvlvigfaddvvtppylgrevadalpngrylqipdaghlg
fferpeavntamlkffasvka
Timeline for d3hzob_: