SCOPe 2.05: Domain d1ee2a1: 1ee2 A:1-162,A:339-373

Lineage for d1ee2a1 (1ee2 A:1-162,A:339-373)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)
   contains barrel, partly opened; n*=4, S*=8; meander

4. Superfamily b.35.1: GroES-like [50129] (3 families)

5. Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
   C-terminal domain is alpha/beta (classical Rossmann-fold)

6. Protein Alcohol dehydrogenase [50137] (9 species)
   contains a Zn-finger subdomain, residues 94-117

7. Species Horse (Equus caballus) [TaxId:9796] [50138] (41 PDB entries)
   Uniprot P00327

8. Domain d1ee2a1: 1ee2 A:1-162,A:339-373 [24663]
   Other proteins in same PDB: d1ee2a2, d1ee2b2
   steroid-active isozyme
   complexed with chd, nad, zn

Details for d1ee2a1

PDB Entry: 1ee2, 1.54 Å

PDB Description: the structure of steroid-active alcohol dehydrogenase at 1.54 a resolution

PDB Compounds: (A:) alcohol dehydrogenase

SCOPe Domain Sequences for d1ee2a1:

Sequence; same for both SEQRES and ATOM records:

>d1ee2a1 b.35.1.2 (A:1-162,A:339-373) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]}
stagkvikckaavlweqkkpfsieevevappkahevrikmvaagicrsddhvvsgtlvap
lpviagheaagivesigegvttvrpgdkviplfipqcgkcsvckhpegnlclknlsmprg
tmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaaXfaldplithvlpfekin
egfdllrsgksirtiltf

Timeline for d1ee2a1:

• d1ee2a1 first appeared (with stable ids) in SCOP 1.55
  
• d1ee2a1 appears in SCOPe 2.04
  
• d1ee2a1 appears in SCOPe 2.06
  
• d1ee2a1 appears in the current release, SCOPe 2.08