Lineage for d1ee2a1 (1ee2 A:1-173,A:324-373)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13334Fold b.35: GroES-like [50128] (2 superfamilies)
  4. 13335Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 13363Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (5 proteins)
  6. 13364Protein Alcohol dehydrogenase [50137] (4 species)
  7. 13368Species Horse (Equus caballus) [TaxId:9796] [50138] (22 PDB entries)
  8. 13369Domain d1ee2a1: 1ee2 A:1-173,A:324-373 [24663]
    Other proteins in same PDB: d1ee2a2, d1ee2b2

Details for d1ee2a1

PDB Entry: 1ee2 (more details), 1.54 Å

PDB Description: the structure of steroid-active alcohol dehydrogenase at 1.54 a resolution
PDB Compounds: (A:)

SCOP Domain Sequences for d1ee2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ee2a1 b.35.1.2 (A:1-173,A:324-373) Alcohol dehydrogenase {Horse (Equus caballus)}
stagkvikckaavlweqkkpfsieevevappkahevrikmvaagicrsddhvvsgtlvap
lpviagheaagivesigegvttvrpgdkviplfipqcgkcsvckhpegnlclknlsmprg
tmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaasplekvclvgcXkdsvpk
lvadfmakkfaldplithvlpfekinegfdllrsgksirtiltf

SCOP Domain Coordinates for d1ee2a1:

Click to download the PDB-style file with coordinates for d1ee2a1.
(The format of our PDB-style files is described here.)

Timeline for d1ee2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ee2a2