Lineage for d1ee2a1 (1ee2 A:1-162,A:339-373)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785352Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 2785353Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 2785485Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 2785506Protein Alcohol dehydrogenase [50137] (9 species)
    contains a Zn-finger subdomain, residues 94-117
  7. 2785523Species Horse (Equus caballus) [TaxId:9796] [50138] (53 PDB entries)
    Uniprot P00327
  8. 2785560Domain d1ee2a1: 1ee2 A:1-162,A:339-373 [24663]
    Other proteins in same PDB: d1ee2a2, d1ee2b2
    steroid-active isozyme
    complexed with chd, nad, zn

Details for d1ee2a1

PDB Entry: 1ee2 (more details), 1.54 Å

PDB Description: the structure of steroid-active alcohol dehydrogenase at 1.54 a resolution
PDB Compounds: (A:) alcohol dehydrogenase

SCOPe Domain Sequences for d1ee2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ee2a1 b.35.1.2 (A:1-162,A:339-373) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]}
stagkvikckaavlweqkkpfsieevevappkahevrikmvaagicrsddhvvsgtlvap
lpviagheaagivesigegvttvrpgdkviplfipqcgkcsvckhpegnlclknlsmprg
tmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaaXfaldplithvlpfekin
egfdllrsgksirtiltf

SCOPe Domain Coordinates for d1ee2a1:

Click to download the PDB-style file with coordinates for d1ee2a1.
(The format of our PDB-style files is described here.)

Timeline for d1ee2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ee2a2