Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (147 species) not a true protein |
Species Methanosarcina mazei [TaxId:2209] [255874] (1 PDB entry) |
Domain d3hz4b_: 3hz4 B: [246629] automated match to d3gnjd_ complexed with edo |
PDB Entry: 3hz4 (more details), 2.3 Å
SCOPe Domain Sequences for d3hz4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hz4b_ c.47.1.0 (B:) automated matches {Methanosarcina mazei [TaxId: 2209]} siiefedmtwsqqvedskkpvvvmfyspacpyckamepyfeeyakeygssavfgriniat npwtaekygvqgtptfkffchgrpvweqvgqiypsilknavrdmlqhgeecirkstpvgq
Timeline for d3hz4b_: