Lineage for d3hz4b_ (3hz4 B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1854430Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1854431Protein automated matches [190056] (147 species)
    not a true protein
  7. 1855215Species Methanosarcina mazei [TaxId:2209] [255874] (1 PDB entry)
  8. 1855217Domain d3hz4b_: 3hz4 B: [246629]
    automated match to d3gnjd_
    complexed with edo

Details for d3hz4b_

PDB Entry: 3hz4 (more details), 2.3 Å

PDB Description: crystal structure of thioredoxin from methanosarcina mazei
PDB Compounds: (B:) thioredoxin

SCOPe Domain Sequences for d3hz4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hz4b_ c.47.1.0 (B:) automated matches {Methanosarcina mazei [TaxId: 2209]}
siiefedmtwsqqvedskkpvvvmfyspacpyckamepyfeeyakeygssavfgriniat
npwtaekygvqgtptfkffchgrpvweqvgqiypsilknavrdmlqhgeecirkstpvgq

SCOPe Domain Coordinates for d3hz4b_:

Click to download the PDB-style file with coordinates for d3hz4b_.
(The format of our PDB-style files is described here.)

Timeline for d3hz4b_: