Lineage for d3hysb_ (3hys B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1615834Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1615835Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1617684Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 1617685Protein automated matches [190543] (56 species)
    not a true protein
  7. 1617935Species Mycobacterium tuberculosis [TaxId:1773] [232505] (4 PDB entries)
  8. 1617939Domain d3hysb_: 3hys B: [246623]
    automated match to d3hssb_
    complexed with edo, mla, na, trs

Details for d3hysb_

PDB Entry: 3hys (more details), 2.3 Å

PDB Description: structure of rv0554 from mycobacterium tuberculosis complexed with malonic acid
PDB Compounds: (B:) protein Rv0554, putative Bromoperoxidase

SCOPe Domain Sequences for d3hysb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hysb_ c.69.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
inlayddngtgdpvvfiagrggagrtwhphqvpaflaagyrcitfdnrgigatenaegft
tqtmvadtaalietldiaparvvgvsmgafiaqelmvvapelvssavlmatrgrldrarq
ffnkaeaelydsgvqlpptydararllenfsrktlnddvavgdwiamfsmwpikstpglr
cqldcapqtnrlpayrniaapvlvigfaddvvtppylgrevadalpngrylqipdaghlg
fferpeavntamlkffasvka

SCOPe Domain Coordinates for d3hysb_:

Click to download the PDB-style file with coordinates for d3hysb_.
(The format of our PDB-style files is described here.)

Timeline for d3hysb_: