Lineage for d3hysa1 (3hys A:2-261)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901917Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2901918Protein automated matches [190543] (131 species)
    not a true protein
  7. 2902533Species Mycobacterium tuberculosis [TaxId:1773] [232505] (4 PDB entries)
  8. 2902536Domain d3hysa1: 3hys A:2-261 [246622]
    Other proteins in same PDB: d3hysa2
    automated match to d3hssb_
    complexed with edo, mla, na, trs

Details for d3hysa1

PDB Entry: 3hys (more details), 2.3 Å

PDB Description: structure of rv0554 from mycobacterium tuberculosis complexed with malonic acid
PDB Compounds: (A:) protein Rv0554, putative Bromoperoxidase

SCOPe Domain Sequences for d3hysa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hysa1 c.69.1.0 (A:2-261) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
inlayddngtgdpvvfiagrggagrtwhphqvpaflaagyrcitfdnrgigatenaegft
tqtmvadtaalietldiaparvvgvsmgafiaqelmvvapelvssavlmatrgrldrarq
ffnkaeaelydsgvqlpptydararllenfsrktlnddvavgdwiamfsmwpikstpglr
cqldcapqtnrlpayrniaapvlvigfaddvvtppylgrevadalpngrylqipdaghlg
fferpeavntamlkffasvk

SCOPe Domain Coordinates for d3hysa1:

Click to download the PDB-style file with coordinates for d3hysa1.
(The format of our PDB-style files is described here.)

Timeline for d3hysa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3hysa2
View in 3D
Domains from other chains:
(mouse over for more information)
d3hysb_