SCOPe 2.08: Domain d3hylb3: 3hyl B:528-666

Lineage for d3hylb3 (3hyl B:528-666)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest

4. Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families)

5. Family c.48.1.0: automated matches [227237] (1 protein)
   not a true family

6. Protein automated matches [226991] (9 species)
   not a true protein

7. Species Bacillus anthracis [TaxId:261594] [255873] (3 PDB entries)

8. Domain d3hylb3: 3hyl B:528-666 [246619]
   Other proteins in same PDB: d3hyla1, d3hyla2, d3hylb1, d3hylb2
   automated match to d1itza3
   complexed with cl, fmt, gol, mg, peg, so4

Details for d3hylb3

PDB Entry: 3hyl, 2.16 Å

PDB Description: crystal structure of transketolase from bacillus anthracis

PDB Compounds: (B:) transketolase

SCOPe Domain Sequences for d3hylb3:

Sequence; same for both SEQRES and ATOM records:

>d3hylb3 c.48.1.0 (B:528-666) automated matches {Bacillus anthracis [TaxId: 261594]}
egakddtyekvakgayvvsaskketadvillatgsevslaveaqkalavdgvdasvvsmp
smdrfeaqtaeykesvlpkavtkrfaiemgatfgwhryvglegdvlgidtfgasapgeki
meeygftvenvvrkvkeml

Timeline for d3hylb3:

• d3hylb3 first appeared in SCOPe 2.04
  
• d3hylb3 appears in SCOPe 2.07