Lineage for d3hyla2 (3hyl A:338-527)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1592643Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 1592644Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. Family c.36.1.0: automated matches [227300] (1 protein)
    not a true family
  6. Protein automated matches [227126] (15 species)
    not a true protein
  7. 1593243Species Bacillus anthracis [TaxId:261594] [255872] (2 PDB entries)
  8. 1593249Domain d3hyla2: 3hyl A:338-527 [246615]
    Other proteins in same PDB: d3hyla3, d3hylb3
    automated match to d1itza2
    complexed with cl, fmt, gol, mg, peg, so4

Details for d3hyla2

PDB Entry: 3hyl (more details), 2.16 Å

PDB Description: crystal structure of transketolase from bacillus anthracis
PDB Compounds: (A:) transketolase

SCOPe Domain Sequences for d3hyla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hyla2 c.36.1.0 (A:338-527) automated matches {Bacillus anthracis [TaxId: 261594]}
lpegweqnlptyelgskaatrnssgavinaiaesvpsffggsadlagsnktymnnekdft
rddysgkniwygvrefamgaamngialhgglktyggtffvfsdylrpairlaalmqlpvt
yvfthdsiavgedgpthepieqlaalrampnvsvirpadgnesvaawrlalestnkptal
vltrqdlptl

SCOPe Domain Coordinates for d3hyla2:

Click to download the PDB-style file with coordinates for d3hyla2.
(The format of our PDB-style files is described here.)

Timeline for d3hyla2: