Lineage for d3hy8a_ (3hy8 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055232Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 2055233Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 2055234Family b.45.1.1: PNP-oxidase like [50476] (17 protein domains)
  6. 2055351Protein automated matches [190383] (6 species)
    not a true protein
  7. 2055358Species Human (Homo sapiens) [TaxId:9606] [188118] (2 PDB entries)
  8. 2055362Domain d3hy8a_: 3hy8 A: [246605]
    automated match to d1nrga_
    complexed with fmn, plp, po4; mutant

Details for d3hy8a_

PDB Entry: 3hy8 (more details), 2.5 Å

PDB Description: Crystal Structure of Human Pyridoxine 5'-Phosphate Oxidase R229W Mutant
PDB Compounds: (A:) Pyridoxine-5'-phosphate oxidase

SCOPe Domain Sequences for d3hy8a_:

Sequence, based on SEQRES records: (download)

>d3hy8a_ b.45.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
feethltsldpvkqfaawfeeavqcpdigeanamclatctrdgkpsarmlllkgfgkdgf
rfftnfesrkgkeldsnpfaslvfyweplnrqvrvegpvkklpeeeaecyfhsrpkssqi
gavvshqssvipdreylrkkneeleqlyqdqevpkpkswggyvlypqvmefwqgqtnrlh
dwivfrrglptgdsplgpmthrgeedwlyerlap

Sequence, based on observed residues (ATOM records): (download)

>d3hy8a_ b.45.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
feethltsldpvkqfaawfeeavqcpdigeanamclatctrdgkpsarmlllkgfgkdgf
rfftnfesrkgkeldsnpfaslvfyweplnrqvrvegpvkklpeeeaecyfhsrpkssqi
gavvshqssvipdreylrkkneeleqlyqdqevpkpkswggyvlypqvmefwqgqtnrlh
dwivfrrglptplgpmthrgeedwlyerlap

SCOPe Domain Coordinates for d3hy8a_:

Click to download the PDB-style file with coordinates for d3hy8a_.
(The format of our PDB-style files is described here.)

Timeline for d3hy8a_: