SCOPe 2.05: Domain d3hxsa_: 3hxs A:

Lineage for d3hxsa_ (3hxs A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (147 species)
   not a true protein

7. Species Bacteroides fragilis [TaxId:817] [255871] (2 PDB entries)

8. Domain d3hxsa_: 3hxs A: [246603]
   automated match to d1fb0a_
   complexed with zn

Details for d3hxsa_

PDB Entry: 3hxs, 2 Å

PDB Description: Crystal Structure of Bacteroides fragilis TrxP

PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d3hxsa_:

Sequence; same for both SEQRES and ATOM records:

>d3hxsa_ c.47.1.0 (A:) automated matches {Bacteroides fragilis [TaxId: 817]}
gtihltraeflkkiadyenhskewkylgdkpaivdfyadwcgpckmvapileelskeyag
kiyiykvnvdkepelardfgiqsiptiwfvpmkgepqvnmgalskeqlkgyidkvll

Timeline for d3hxsa_:

• d3hxsa_ first appeared in SCOPe 2.04
  
• d3hxsa_ appears in SCOPe 2.06
  
• d3hxsa_ appears in the current release, SCOPe 2.08