Lineage for d3hxsa_ (3hxs A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879112Species Bacteroides fragilis [TaxId:817] [255871] (2 PDB entries)
  8. 2879113Domain d3hxsa_: 3hxs A: [246603]
    automated match to d1fb0a_
    complexed with zn

Details for d3hxsa_

PDB Entry: 3hxs (more details), 2 Å

PDB Description: Crystal Structure of Bacteroides fragilis TrxP
PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d3hxsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hxsa_ c.47.1.0 (A:) automated matches {Bacteroides fragilis [TaxId: 817]}
gtihltraeflkkiadyenhskewkylgdkpaivdfyadwcgpckmvapileelskeyag
kiyiykvnvdkepelardfgiqsiptiwfvpmkgepqvnmgalskeqlkgyidkvll

SCOPe Domain Coordinates for d3hxsa_:

Click to download the PDB-style file with coordinates for d3hxsa_.
(The format of our PDB-style files is described here.)

Timeline for d3hxsa_: