SCOPe 2.08: Domain d3hwbb_: 3hwb B:

Lineage for d3hwbb_ (3hwb B:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
   not a true fold, gathers together transmembrane barrels of different (n,S)
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.4.3: Porins [56935] (5 families)

5. Family f.4.3.1: Porin [56936] (2 proteins)
   trimer, one subunit folds into (16,20) barrel

6. Protein Porin [56937] (5 species)

7. Species Escherichia coli, different sequences [TaxId:562] [56938] (29 PDB entries)

8. Domain d3hwbb_: 3hwb B: [246602]
   automated match to d1hxua_
   complexed with p6g, rb

Details for d3hwbb_

PDB Entry: 3hwb, 3 Å

PDB Description: Cation selective pathway of OmpF porin revealed by anomalous diffraction

PDB Compounds: (B:) Outer membrane protein F

SCOPe Domain Sequences for d3hwbb_:

Sequence; same for both SEQRES and ATOM records:

>d3hwbb_ f.4.3.1 (B:) Porin {Escherichia coli, different sequences [TaxId: 562]}
aeiynkdgnkvdlygkavglhyfskgngensyggngdmtyarlgfkgetqinsdltgygq
weynfqgnnsegadaqtgnktrlafaglkyadvgsfdygrnygvvydalgytdmlpefgg
dtaysddffvgrvggvatyrnsnffglvdglnfavqylgknerdtarrsngdgvggsisy
eyegfgivgaygaadrtnlqeaqplgngkkaeqwatglkydanniylaanygetrnatpi
tnkftntsgfanktqdvllvaqyqfdfglrpsiaytkskakdvegigdvdlvnyfevgat
yyfnknmstyvdyiinqidsdnklgvgsddtvavgivyqf

Timeline for d3hwbb_:

• d3hwbb_ first appeared in SCOPe 2.04
  
• d3hwbb_ appears in SCOPe 2.07