Lineage for d3hw8a1 (3hw8 A:249-328)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2715906Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2715907Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)
  6. 2716076Protein DNA polymerase lambda [101251] (1 species)
  7. 2716077Species Human (Homo sapiens) [TaxId:9606] [101252] (28 PDB entries)
  8. 2716082Domain d3hw8a1: 3hw8 A:249-328 [246598]
    Other proteins in same PDB: d3hw8a2, d3hw8a3
    automated match to d1rzta1
    protein/DNA complex; complexed with d3t, edo, mg, na

Details for d3hw8a1

PDB Entry: 3hw8 (more details), 1.95 Å

PDB Description: ternary complex of dna polymerase lambda of a two nucleotide gapped dna substrate with a c in the scrunch site
PDB Compounds: (A:) DNA polymerase lambda

SCOPe Domain Sequences for d3hw8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hw8a1 a.60.6.1 (A:249-328) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
atnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkr
maekiieilesghlrkldhi

SCOPe Domain Coordinates for d3hw8a1:

Click to download the PDB-style file with coordinates for d3hw8a1.
(The format of our PDB-style files is described here.)

Timeline for d3hw8a1: