SCOPe 2.05: Domain d3hw5c_: 3hw5 C:

Lineage for d3hw5c_ (3hw5 C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (35 families)

5. Family c.52.1.34: PA N-terminal domain [254166] (2 proteins)
   Pfam PF00603; relationship to endonucleases discussed in PubMed 19194458

6. Protein PA N-terminal domain [254375] (5 species)

7. Species Influenza A virus [TaxId:93838] [254808] (15 PDB entries)

8. Domain d3hw5c_: 3hw5 C: [246592]
   automated match to d3ebja_
   complexed with amp, mg

Details for d3hw5c_

PDB Entry: 3hw5, 1.81 Å

PDB Description: crystal structure of avian influenza virus PA_N in complex with AMP

PDB Compounds: (C:) Polymerase acidic protein

SCOPe Domain Sequences for d3hw5c_:

Sequence, based on SEQRES records:

>d3hw5c_ c.52.1.34 (C:) PA N-terminal domain {Influenza A virus [TaxId: 93838]}
plgsmedfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdfhfide
rgestiiesgdpnallkhrfeiiegrdrtmawtvvnsicnttgvekpkflpdlydykenr
fieigvtrrevhtyylekankiksekthihifsftgeematkadytldeesrariktrlf
tirqemasrglwdsfrqserg

Sequence, based on observed residues (ATOM records):

>d3hw5c_ c.52.1.34 (C:) PA N-terminal domain {Influenza A virus [TaxId: 93838]}
plgsmedfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysrfeiieg
rdrtmawtvvnsicnttgvekpkflpdlydykenrfieigvtrrevhtyylekankikse
kthihifsftgeematkadytldeesrariktrlftirqemasrglwdsfrqserg

Timeline for d3hw5c_:

• d3hw5c_ first appeared in SCOPe 2.04
  
• d3hw5c_ is called d3hw5c1 in SCOPe 2.06
  
• d3hw5c_ appears in the current release, SCOPe 2.08, called d3hw5c1