SCOPe 2.06: Domain d3hw3b1: 3hw3 B:1-197

Lineage for d3hw3b1 (3hw3 B:1-197)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (36 families)

5. Family c.52.1.34: PA N-terminal domain [254166] (2 proteins)
   Pfam PF00603; relationship to endonucleases discussed in PubMed 19194458

6. Protein PA N-terminal domain [254375] (5 species)

7. Species Influenza A virus [TaxId:93838] [254808] (31 PDB entries)

8. Domain d3hw3b1: 3hw3 B:1-197 [246583]
   Other proteins in same PDB: d3hw3a2, d3hw3b2, d3hw3c2, d3hw3d2
   automated match to d3ebja_
   complexed with mg, u5p

Details for d3hw3b1

PDB Entry: 3hw3, 1.9 Å

PDB Description: The crystal structure of avian influenza virus PA_N in complex with UMP

PDB Compounds: (B:) Polymerase acidic protein

SCOPe Domain Sequences for d3hw3b1:

Sequence, based on SEQRES records:

>d3hw3b1 c.52.1.34 (B:1-197) PA N-terminal domain {Influenza A virus [TaxId: 93838]}
medfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdfhfiderges
tiiesgdpnallkhrfeiiegrdrtmawtvvnsicnttgvekpkflpdlydykenrfiei
gvtrrevhtyylekankiksekthihifsftgeematkadytldeesrariktrlftirq
emasrglwdsfrqserg

Sequence, based on observed residues (ATOM records):

>d3hw3b1 c.52.1.34 (B:1-197) PA N-terminal domain {Influenza A virus [TaxId: 93838]}
medfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdfhfhrfeiie
grdrtmawtvvnsicnttgvekpkflpdlydykenrfieigvtrrevhtyylekankiks
ekthihifsftgeematkadytldeesrariktrlftirqemasrglwdsfrqserg

Timeline for d3hw3b1:

• d3hw3b1 first appeared in SCOPe 2.04, called d3hw3b_
  
• d3hw3b1 was called d3hw3b_ in SCOPe 2.05
  
• d3hw3b1 appears in SCOPe 2.07
  
• d3hw3b1 appears in the current release, SCOPe 2.08