SCOPe 2.04: Domain d3hw3b_: 3hw3 B:

Lineage for d3hw3b_ (3hw3 B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (35 families)

5. Family c.52.1.34: PA N-terminal domain [254166] (2 proteins)
   Pfam PF00603; relationship to endonucleases discussed in PubMed 19194458

6. Protein PA N-terminal domain [254375] (3 species)

7. Species Influenza A virus [TaxId:93838] [254808] (13 PDB entries)

8. Domain d3hw3b_: 3hw3 B: [246583]
   automated match to d3ebja_
   complexed with mg, u5p

Details for d3hw3b_

PDB Entry: 3hw3, 1.9 Å

PDB Description: The crystal structure of avian influenza virus PA_N in complex with UMP

PDB Compounds: (B:) Polymerase acidic protein

SCOPe Domain Sequences for d3hw3b_:

Sequence, based on SEQRES records:

>d3hw3b_ c.52.1.34 (B:) PA N-terminal domain {Influenza A virus [TaxId: 93838]}
lgsmedfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdfhfider
gestiiesgdpnallkhrfeiiegrdrtmawtvvnsicnttgvekpkflpdlydykenrf
ieigvtrrevhtyylekankiksekthihifsftgeematkadytldeesrariktrlft
irqemasrglwdsfrqserg

Sequence, based on observed residues (ATOM records):

>d3hw3b_ c.52.1.34 (B:) PA N-terminal domain {Influenza A virus [TaxId: 93838]}
lgsmedfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdfhfhrfe
iiegrdrtmawtvvnsicnttgvekpkflpdlydykenrfieigvtrrevhtyylekank
iksekthihifsftgeematkadytldeesrariktrlftirqemasrglwdsfrqserg

Timeline for d3hw3b_:

• d3hw3b_ is new in SCOPe 2.04-stable
  
• d3hw3b_ appears in SCOPe 2.05
  
• d3hw3b_ appears in the current release, SCOPe 2.08, called d3hw3b1