Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
Superfamily c.52.1: Restriction endonuclease-like [52980] (35 families) |
Family c.52.1.34: PA N-terminal domain [254166] (2 proteins) Pfam PF00603; relationship to endonucleases discussed in PubMed 19194458 |
Protein PA N-terminal domain [254375] (3 species) |
Species Influenza A virus [TaxId:93838] [254808] (13 PDB entries) |
Domain d3hw3b_: 3hw3 B: [246583] automated match to d3ebja_ complexed with mg, u5p |
PDB Entry: 3hw3 (more details), 1.9 Å
SCOPe Domain Sequences for d3hw3b_:
Sequence, based on SEQRES records: (download)
>d3hw3b_ c.52.1.34 (B:) PA N-terminal domain {Influenza A virus [TaxId: 93838]} lgsmedfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdfhfider gestiiesgdpnallkhrfeiiegrdrtmawtvvnsicnttgvekpkflpdlydykenrf ieigvtrrevhtyylekankiksekthihifsftgeematkadytldeesrariktrlft irqemasrglwdsfrqserg
>d3hw3b_ c.52.1.34 (B:) PA N-terminal domain {Influenza A virus [TaxId: 93838]} lgsmedfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdfhfhrfe iiegrdrtmawtvvnsicnttgvekpkflpdlydykenrfieigvtrrevhtyylekank iksekthihifsftgeematkadytldeesrariktrlftirqemasrglwdsfrqserg
Timeline for d3hw3b_: