![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.35: GroES-like [50128] (2 superfamilies) contains barrel, partly opened; n*=4, S*=8; meander |
![]() | Superfamily b.35.1: GroES-like [50129] (3 families) ![]() |
![]() | Family b.35.1.1: GroES [50130] (2 proteins) automatically mapped to Pfam PF00166 |
![]() | Protein GP31 co-chaperonin [50134] (1 species) |
![]() | Species Bacteriophage T4 [TaxId:10665] [50135] (2 PDB entries) |
![]() | Domain d1g31c_: 1g31 C: [24658] complexed with k, po4 |
PDB Entry: 1g31 (more details), 2.3 Å
SCOPe Domain Sequences for d1g31c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g31c_ b.35.1.1 (C:) GP31 co-chaperonin {Bacteriophage T4 [TaxId: 10665]} qqlpiravgeyvilvsepaqagdeevtesgliigkrvqgevpelcvvhsvgpdvpegfce vgdltslpvgqirnvphpfvalglkqpkeikqkfvtchykaipclyk
Timeline for d1g31c_: