![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
![]() | Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) ![]() Similar in architecture to the superfamily II but partly differs in topology |
![]() | Family c.93.1.0: automated matches [191439] (1 protein) not a true family |
![]() | Protein automated matches [190646] (77 species) not a true protein |
![]() | Species Staphylococcus haemolyticus [TaxId:279808] [255868] (1 PDB entry) |
![]() | Domain d3huuc_: 3huu C: [246579] Other proteins in same PDB: d3huub2 automated match to d3hcwa_ |
PDB Entry: 3huu (more details), 1.95 Å
SCOPe Domain Sequences for d3huuc_:
Sequence, based on SEQRES records: (download)
>d3huuc_ c.93.1.0 (C:) automated matches {Staphylococcus haemolyticus [TaxId: 279808]} ktltigliqkssapeirqnpfnsdvlnginqacnvrgystrmtvsensgdlyhevktmiq sksvdgfillyslkddpiehllnefkvpylivgkslnyeniihidndnidaayqltqyly hlghrhilflqesghyavtedrsvgfkqycddvkisndcvviksmndlrdfikqycidas hmpsviitsdvmlnmqllnvlyeyqlripediqtatfntsfltenatpsqtsvninpdvl gftagntiidvlrnetisfreklistqivervsttki
>d3huuc_ c.93.1.0 (C:) automated matches {Staphylococcus haemolyticus [TaxId: 279808]} ktltigliqkssapeirqnpfnsdvlnginqacnvrgystrmtvsensgdlyhevktmiq sksvdgfillyslkddpiehllnefkvpylivgkslnyeniihidndnidaayqltqyly hlghrhilflqesghyavtedrsvgfkqycddvkisndcvviksmndlrdfikqympsvi itsdvmlnmqllnvlyeyqlripediqtatfntsfltenatpsqtsvninpdvlgftagn tiidvlrnfreklistqivervsttki
Timeline for d3huuc_:
![]() Domains from other chains: (mouse over for more information) d3huua_, d3huub1, d3huub2, d3huud_ |