Lineage for d3huuc_ (3huu C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143708Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2143709Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2143989Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 2143990Protein automated matches [190646] (70 species)
    not a true protein
  7. 2144248Species Staphylococcus haemolyticus [TaxId:279808] [255868] (1 PDB entry)
  8. 2144251Domain d3huuc_: 3huu C: [246579]
    Other proteins in same PDB: d3huub2
    automated match to d3hcwa_

Details for d3huuc_

PDB Entry: 3huu (more details), 1.95 Å

PDB Description: Crystal structure of transcription regulator like protein from Staphylococcus haemolyticus
PDB Compounds: (C:) Transcription regulator like protein

SCOPe Domain Sequences for d3huuc_:

Sequence, based on SEQRES records: (download)

>d3huuc_ c.93.1.0 (C:) automated matches {Staphylococcus haemolyticus [TaxId: 279808]}
ktltigliqkssapeirqnpfnsdvlnginqacnvrgystrmtvsensgdlyhevktmiq
sksvdgfillyslkddpiehllnefkvpylivgkslnyeniihidndnidaayqltqyly
hlghrhilflqesghyavtedrsvgfkqycddvkisndcvviksmndlrdfikqycidas
hmpsviitsdvmlnmqllnvlyeyqlripediqtatfntsfltenatpsqtsvninpdvl
gftagntiidvlrnetisfreklistqivervsttki

Sequence, based on observed residues (ATOM records): (download)

>d3huuc_ c.93.1.0 (C:) automated matches {Staphylococcus haemolyticus [TaxId: 279808]}
ktltigliqkssapeirqnpfnsdvlnginqacnvrgystrmtvsensgdlyhevktmiq
sksvdgfillyslkddpiehllnefkvpylivgkslnyeniihidndnidaayqltqyly
hlghrhilflqesghyavtedrsvgfkqycddvkisndcvviksmndlrdfikqympsvi
itsdvmlnmqllnvlyeyqlripediqtatfntsfltenatpsqtsvninpdvlgftagn
tiidvlrnfreklistqivervsttki

SCOPe Domain Coordinates for d3huuc_:

Click to download the PDB-style file with coordinates for d3huuc_.
(The format of our PDB-style files is described here.)

Timeline for d3huuc_: